missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SLC2A3 Partial ORF (NP_008862.1, 213 a.a. - 263 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00006515-Q01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16195355

  • 302.00€ / 10 microgramos


Fecha estimada de envío
26-10-2020
Añadir a la cesta

Descripción

Descripción

Sequence: LINRKEEENAKQILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRV
Especificaciones

Especificaciones

NP_008862.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
31.35kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
LINRKEEENAKQILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRV
RUO
SLC2A3
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
6515
SLC2A3 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ90380|GLUT3
SLC2A3
Yes
Videos
Documentos