missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human SLC26A4 Partial ORF (NP_000432, 674 a.a. - 754 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00005172-Q01.25ug
Detalles adicionales : Peso : 0.00010kg
Descripción
Mutations in this gene are associated with Pendred syndrome, the most common form of syndromic deafness, an autosomal-recessive disease. It is highly homologous to the SLC26A3 gene; they have similar genomic structures and this gene is located 3' of the SLC26A3 gene. The encoded protein has homology to sulfate transporters. [provided by RefSeq]
Sequence: RSLRVIVKEFQRIDVNVYFASLQDYVIEKLEQCGFFDDNIRKDTFFLTVHDAILYLQNQVKSQEGQGSILETITLIQDCKDEspecificaciones
| NP_000432 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 34.65kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| RSLRVIVKEFQRIDVNVYFASLQDYVIEKLEQCGFFDDNIRKDTFFLTVHDAILYLQNQVKSQEGQGSILETITLIQDCKD | |
| RUO | |
| SLC26A4 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 5172 | |
| SLC26A4 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| DFNB4/EVA/PDS | |
| SLC26A4 | |
| Recombinant | |
| wheat germ expression system |