Learn More
Abnova™ Human SLC22A5 Partial ORF (NP_003051, 511 a.a. - 557 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00006584-Q01.10ug
Detalles adicionales : Peso : 0.00010kg
Descripción
Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. The encoded protein is a plasma integral membrane protein which functions both as an organic cation transporter and as a sodium-dependent high affinity carnitine transporter. The encoded protein is involved in the active cellular uptake of carnitine. Mutations in this gene are the cause of systemic primary carnitine deficiency (CDSP), an autosomal recessive disorder manifested early in life by hypoketotic hypoglycemia and acute metabolic decompensation, and later in life by skeletal myopathy or cardiomyopathy. [provided by RefSeq]
Sequence: ESFGTPLPDTIDQMLRVKGMKHRKTPSHTRMLKDGQERPTILKSTAFEspecificaciones
NP_003051 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
30.91kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
ESFGTPLPDTIDQMLRVKGMKHRKTPSHTRMLKDGQERPTILKSTAF | |
RUO | |
SLC22A5 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
6584 | |
SLC22A5 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
CDSP/FLJ46769/OCTN2/OCTN2VT | |
SLC22A5 | |
Recombinant | |
wheat germ expression system |