missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human SETDB1 Partial ORF (NP_036564, 247 a.a. - 348 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Especificaciones
| Número de acceso | NP_036564 |
|---|---|
| Para utilizar con (aplicación) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulación | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| ID de gen (Entrez) | 9869 |
| Peso molecular | 36.85kDa |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
16045185
|
Abnova™
H00009869-Q02.25UG |
25 ug |
508.00€
25 microgramos |
Fecha estimada de envío: 05-06-2024 Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
|
16035185
|
Abnova™
H00009869-Q02.10UG |
10 ug |
335.00€
10 microgramos |
Fecha estimada de envío: 05-06-2024 Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
Descripción
This gene encodes a histone methyltransferase. The encoded enzyme catalyzes the reaction of S-adenosyl-L-methionine and histone L-lysine to produce S-adenosyl-L-homocysteine and histone N(6)-methyl-L-lysine. The encoded protein likely functions in transcriptional repression. Alternatively spliced transcript variants have been described
Sequence: IAYDYHPPADKLYVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDGYASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYVTAYPNRPMVLLEspecificaciones
| NP_036564 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.85kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| ESET/KG1T/KIAA0067/KMT1E | |
| SETDB1 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 9869 | |
| SETDB1 (Human) Recombinant Protein (Q02) | |
| IAYDYHPPADKLYVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDGYASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYVTAYPNRPMVLL | |
| RUO | |
| SETDB1 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |