missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RPP14 Partial ORF (NP_008973, 1 a.a. - 75 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00011102-Q01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16103716

  • 335.00€ / 10 microgramos
Envío estimado: 14-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

Sequence: MPAPAATYERVVYKNPSEYHYMKVCLEFQDCGVGLNAAQFKQLLISAVKDLFGEVDAALPLDILTYEEKTLSAIL
Especificaciones

Especificaciones

NP_008973
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33.99kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MPAPAATYERVVYKNPSEYHYMKVCLEFQDCGVGLNAAQFKQLLISAVKDLFGEVDAALPLDILTYEEKTLSAIL
RUO
RPP14
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
11102
RPP14 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ31508/P14
RPP14
Yes
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales