missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human RP2 Partial ORF (NP_008846, 251 a.a. - 350 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Especificaciones
Número de acceso | NP_008846 |
---|---|
Para utilizar con (aplicación) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulación | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
ID de gen (Entrez) | 6102 |
Peso molecular | 36.74kDa |
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
---|---|---|---|---|---|---|---|---|---|
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
16194495
|
Abnova™
H00006102-Q01.25UG |
25 ug |
508.00€
25 microgramos |
Fecha estimada de envío: 30-05-2024 Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
16184495
|
Abnova™
H00006102-Q01.10UG |
10 ug |
335.00€
10 microgramos |
Fecha estimada de envío: 30-05-2024 Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
Descripción
The RP2 locus has been implicated as one cause of X-linked retinitis pigmentosa. The predicted gene product shows homology with human cofactor C, a protein involved in the ultimate step of beta-tubulin folding. Progressive retinal degeneration may therefore be due to the accumulation of incorrectly-folded photoreceptor or neuron-specific tubulin isoforms followed by progressive cell death [provided by RefSeq]
Sequence: RKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGIEspecificaciones
NP_008846 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.74kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
DELXp11.3/KIAA0215/TBCCD2 | |
RP2 | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
6102 | |
RP2 (Human) Recombinant Protein (Q01) | |
RKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGI | |
RUO | |
RP2 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |