missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RNPC2 Partial ORF (NP_909122, 423 a.a. - 472 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00009584-Q01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16100986

  • 341.70€ / 10 microgramos
Envío estimado: 24-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

The protein encoded by this gene is an RNA binding protein and possible splicing factor. The encoded protein is found in the nucleus, where it colocalizes with core spliceosomal proteins. Studies of a mouse protein with high sequence similarity to this protein suggest that this protein may act as a transcriptional coactivator for JUN/AP-1 and estrogen receptors. Multiple transcript variants encoding different isoforms have been observed for this gene. [provided by RefSeq]

Sequence: TQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQG
Especificaciones

Especificaciones

NP_909122
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
31.24kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
TQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQG
RUO
RBM39
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
9584
RNPC2 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CAPER/CAPERalpha/CC1.3/DKFZp781C0423/FLJ44170/HCC1/RNPC2/fSAP59
RBM39
Yes
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales