missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human RNF186 Partial ORF (NP_061935, 75 a.a. - 150 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00054546-Q01.10ug
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Sequence: DNTWSITCPLCRKVTAVPGGLICSLRDHEAVVGQLAQPCTEVSLCPQGLVDPADLAAGHPSLVGEDGQDEVSANHVEspecificaciones
NP_061935 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
34.1kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
DNTWSITCPLCRKVTAVPGGLICSLRDHEAVVGQLAQPCTEVSLCPQGLVDPADLAAGHPSLVGEDGQDEVSANHV | |
RUO | |
RNF186 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
54546 | |
RNF186 (Human) Recombinant Protein (Q01) | |
10 μg | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
FLJ20225/RP11-91K11.1 | |
RNF186 | |
Recombinant | |
wheat germ expression system |