missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RFNG Partial ORF (AAC51359.1, 82 a.a. - 190 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marque:  Abnova™ H00005986-Q01.25ug

Informations supplémentaires : Peso : 0.00010kg

 Afficher plus de versions de ce produit

Code produit. 16104315

  • 518.16€ / 25 microgramos
Envío estimado: 24-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Description

Description

Sequence: LGSFMSTAEQVRLPDDCTVGYIVEGLLGARLLHSPLFHSHLENLQRLPPDTLLQQVTLSHGGPENPQNVVNVAGGFSLHQDPTRFKSIHCLLYPDTDWCPRQKQGAPTS
Spécification

Spécification

AAC51359.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.73kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
LGSFMSTAEQVRLPDDCTVGYIVEGLLGARLLHSPLFHSHLENLQRLPPDTLLQQVTLSHGGPENPQNVVNVAGGFSLHQDPTRFKSIHCLLYPDTDWCPRQKQGAPTS
RUO
RFNG
Yes
wheat germ expression system
Liquid
5986
RFNG (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
RFNG
Wheat Germ (in vitro)
GST
Vidéos
FDS
Documents
Certificats
Promotions

Promotions