missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RCV1 Partial ORF (AAH01720.1, 91 a.a. - 181 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00005957-Q03.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16104225

  • 518.16€ / 25 microgramos
Envío estimado: 18-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

This gene encodes a member of the recoverin family of neuronal calcium sensors. The encoded protein contains three calcium-binding EF-hand domains and may prolong the termination of the phototransduction cascade in the retina by blocking the phosphorylation of photo-activated rhodopsin. Recoverin may be the antigen responsible for cancer-associated retinopathy. [provided by RefSeq]

Sequence: HMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKE
Especificaciones

Especificaciones

AAH01720.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.64kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
HMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKE
RUO
RCVRN
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
5957
RCV1 (Human) Recombinant Protein (Q03)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
RCV1
RCVRN
Yes
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales