missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RAB34 Partial ORF (NP_114140.2, 170 a.a. - 259 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00083871-Q01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16100557

  • 518.16€ / 25 microgramos
Envío estimado: 21-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

RAB proteins, like RAB34, are small GTPases that regulate vesicle budding, docking, and fusion along endocytosis and exocytosis pathways (Chen et al., 2003 [PubMed 12684051]).[supplied by OMIM]

Sequence: LSTPAQYALMEKDALQVAQEMKAEYWAVSSLTGENVREFFFRVAALTFEANVLAELEKSGARRIGDVVRINSDDSNLYLTASKKKPTCCP
Especificaciones

Especificaciones

NP_114140.2
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.64kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
LSTPAQYALMEKDALQVAQEMKAEYWAVSSLTGENVREFFFRVAALTFEANVLAELEKSGARRIGDVVRINSDDSNLYLTASKKKPTCCP
RUO
RAB34
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
83871
RAB34 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
RAB39/RAH
RAB34
Yes
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales