missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PRKCD Partial ORF (NP_006245, 577 a.a. - 676 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

359.00€ - 545.00€

Especificaciones

Nombre PRKCD (Human) Recombinant Protein (Q02)
Recombinante Yes
Para utilizar con (aplicación) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Peso molecular 36.74kDa
Requisitos de almacenamiento Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Ver más especificaciones

Productos 2
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
16094565
Ver documentos Detalles de la promoción
Abnova™
H00005580-Q02.10UG
10 ug
359.00€
10 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 19-07-2022
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
16004575
Ver documentos Detalles de la promoción
Abnova™
H00005580-Q02.25UG
25 ug
545.00€
25 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 19-07-2022
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Descripción

Descripción

Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play distinct roles in cells. The protein encoded by this gene is one of the PKC family members. Studies both in human and mice demonstrate that this kinase is involved in B cell signaling and in the regulation of growth, apoptosis, and differentiation of a variety of cell types. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq]

Sequence: DILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAFAGFSFVNPKFEHLLED
Especificaciones

Especificaciones

PRKCD (Human) Recombinant Protein (Q02)
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Yes
36.74kDa
SDS
Product Certifications