Abnova™ Human PPP1R1C Full-length ORF (AAH17943.1, 1 a.a. - 109 a.a.) Recombinant Protein with GST-tag at N-terminal

Name: Abnova&trade; Human PPP1R1C Full-length ORF (AAH17943.1, 1 a.a. - 109 a.a.) Recombinant Protein with GST-tag at N-terminal
Brand: Abnova&trade;
SKU: p-7103563

Used for AP, Array, ELISA, WB-Re

335.00€ - 508.00€

Especificaciones

Número de acceso	AAH17943.1
Para utilizar con (aplicación)	Antibody Production, Protein Array, ELISA, Western Blot
Formulación	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
ID de gen (Entrez)	151242
Peso molecular	37.73kDa

Ver más especificaciones

Productos 2

Código de producto	Marca	Cantidad	Precio	Cantidad y disponibilidad
Código de producto	Marca	Cantidad	Precio	Cantidad y disponibilidad
16118663 Ver documentos Detalles de la promoción missing translation for 'viewProductCertificates'	Abnova™ H00151242-P01.25UG	25 ug	508.00€ 25 microgramos Ver productos alternativos Ahorre hasta »	Fecha estimada de envío: 31-05-2024 Inicie sesión para ver el stock	Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

16108663 Ver documentos Detalles de la promoción missing translation for 'viewProductCertificates'	Abnova™ H00151242-P01.10UG	10 ug	335.00€ 10 microgramos Ver productos alternativos Ahorre hasta »	Fecha estimada de envío: 31-05-2024 Inicie sesión para ver el stock	Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Descripción

Sequence: MEPNSPKKIQFAVPVFQSQIAPEAAEQIRKRRPTPASLVILNEHNPPEIDDKRGPNTQGELQNASPKQRKQSVYTPPTIKGVKHLKGQNESAFPEEEEGTNEREEQRDH

Especificaciones

Número de acceso	AAH17943.1
Formulación	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Peso molecular	37.73kDa
Método de purificación	Glutathione Sepharose 4 Fast Flow
Inmunógeno	MEPNSPKKIQFAVPVFQSQIAPEAAEQIRKRRPTPASLVILNEHNPPEIDDKRGPNTQGELQNASPKQRKQSVYTPPTIKGVKHLKGQNESAFPEEEEGTNEREEQRDH
Estado normativo	RUO
Nombre común	PPP1R1C
Especie	Wheat Germ (in vitro)
Etiqueta de proteína	GST
Formulario	Liquid

Para utilizar con (aplicación)	Antibody Production, Protein Array, ELISA, Western Blot
ID de gen (Entrez)	151242
Nombre	PPP1R1C (Human) Recombinant Protein (P01)
Pruebas de control de calidad	12.5% SDS-PAGE Stained with Coomassie Blue.
Requisitos de almacenamiento	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias de gen	IPP5
Símbolo de gen	PPP1R1C
Recombinante	Recombinant
Sistema de expresión	wheat germ expression system

Volver al principio de esta página

Abnova™ Human PPP1R1C Full-length ORF (AAH17943.1, 1 a.a. - 109 a.a.) Recombinant Protein with GST-tag at N-terminal

Especificaciones

Descripción

Especificaciones

Documentos