missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PPP1CA Partial ORF (NP_002699, 224 a.a. - 330 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00005499-Q01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16109421

  • 518.16€ / 25 microgramos
Envío estimado: 20-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Increased PP1 activity has been observed in the end stage of heart failure. Studies in both human and mice suggest that PP1 is an important regulator of cardiac function. Mouse studies also suggest that PP1 functions as a suppressor of learning and memory. Three alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: SFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK
Especificaciones

Especificaciones

NP_002699
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.51kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK
RUO
PPP1CA
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
5499
PPP1CA (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC15877/MGC1674/PP-1A/PPP1A
PPP1CA
Yes
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales