missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human PLAUR Partial ORF (NP_002650, 25 a.a. - 134 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Especificaciones
| Número de acceso | NP_002650 |
|---|---|
| Para utilizar con (aplicación) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulación | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| ID de gen (Entrez) | 5329 |
| Peso molecular | 37.84kDa |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
16109171
|
Abnova™
H00005329-Q01.25UG |
25 ug |
508.00€
25 microgramos |
Fecha estimada de envío: 03-06-2024 Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
|
16199161
|
Abnova™
H00005329-Q01.10UG |
10 ug |
335.00€
10 microgramos |
Fecha estimada de envío: 03-06-2024 Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
Descripción
This gene encodes the receptor for urokinase plasminogen activator and, given its role in localizing and promoting plasmin formation, likely influences many normal and pathological processes related to cell-surface plasminogen activation and localized degradation of the extracellular matrix. It binds both the proprotein and mature forms of urokinase plasminogen activator and permits the activation of the receptor-bound pro-enzyme by plasmin. The protein lacks transmembrane or cytoplasmic domains and may be anchored to the plasma membrane by a glycosyl-phosphatidylinositol (GPI) moiety following cleavage of the nascent polypeptide near its carboxy-terminus. However, a soluble protein is also produced in some cell types. Alternative splicing results in multiple transcript variants encoding different isoforms. The proprotein experiences several post-translational cleavage reactions that have not yet been fully defined. [provided by RefSeq]
Sequence: CMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEEPELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSEspecificaciones
| NP_002650 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 37.84kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CD87/UPAR/URKR | |
| PLAUR | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 5329 | |
| PLAUR (Human) Recombinant Protein (Q01) | |
| CMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEEPELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQS | |
| RUO | |
| PLAUR | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |