missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PIP5K2A Partial ORF (NP_005019, 304 a.a. - 365 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00005305-Q01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16192845

  • 310.00€ / 10 microgramos


Fecha estimada de envío
15-02-2021
Añadir a la cesta

Beschreibung

Beschreibung

Sequence: SDGTHPVGTPPDSPGNTLNSSPPLAPGEFDPNIDVYGIKCHENSPRKEVYFMAIIDILTHYD
Spezifikation

Spezifikation

NP_005019
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
32.56kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SDGTHPVGTPPDSPGNTLNSSPPLAPGEFDPNIDVYGIKCHENSPRKEVYFMAIIDILTHYD
RUO
PIP4K2A
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
5305
PIP5K2A (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ13267|PI5P4KA|PIP5K2A|PIP5KII-alpha|PIP5KIIA|PIPK
PIP4K2A
Yes
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation