missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human P2RY14 Partial ORF (AAH34989.1, 239 a.a. - 338 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00009934-Q01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16191466

  • 310.00€ / 10 microgramos


Fecha estimada de envío
19-02-2021
Añadir a la cesta

Descripción

Descripción

Sequence: VFVFFVCFVPYHIARIPYTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQPFREILCKKLHIPLKAQNDLDISRIKRGNTTLESTDTL
Especificaciones

Especificaciones

AAH34989.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue
VFVFFVCFVPYHIARIPYTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQPFREILCKKLHIPLKAQNDLDISRIKRGNTTLESTDTL
RUO
P2RY14
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
9934
P2RY14 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
GPR105|KIAA0001|P2Y14
P2RY14
Yes
Videos
SDS
Documentos