missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human P2RY1 Partial ORF (NP_002554, 1 a.a. - 52 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00005028-Q01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16102295

  • 341.70€ / 10 microgramos
Envío estimado: 18-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor functions as a receptor for extracellular ATP and ADP. In platelets binding to ADP leads to mobilization of intracellular calcium ions via activation of phospholipase C, a change in platelet shape, and probably to platelet aggregation. [provided by RefSeq]

Sequence: MTEVLWPAVPNGTDAAFLAGPGSSWGNSTVASTAAVSSSFKCALTKTGFQFY
Especificaciones

Especificaciones

NP_002554
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
31.46kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MTEVLWPAVPNGTDAAFLAGPGSSWGNSTVASTAAVSSSFKCALTKTGFQFY
RUO
P2RY1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
5028
P2RY1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
P2Y1
P2RY1
Yes
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales