missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human NRP1 Partial ORF (NP_003864.4, 22 a.a. - 131 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00008829-Q01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16199375

  • 458.00€ / 25 microgramos


Fecha estimada de envío
29-10-2020
Añadir a la cesta

Descripción

Descripción

Sequence: FRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHG
Especificaciones

Especificaciones

NP_003864.4
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.73kDa
12.5% SDS-PAGE Stained with Coomassie Blue
FRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHG
RUO
NRP1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
8829
NRP1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
BDCA4|CD304|DKFZp686A03134|DKFZp781F1414|NP1|NRP|VEGF165R
NRP1
Yes
Videos
Documentos