Learn More
Abnova™ Human NR1I3 Partial ORF (NP_005113.1, 2 a.a. - 59 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Especificaciones
Número de acceso | NP_005113.1 |
---|---|
Para utilizar con (aplicación) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulación | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
ID de gen (Entrez) | 9970 |
Peso molecular | 32.12kDa |
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
---|---|---|---|---|---|---|---|---|---|
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
16005205
|
Abnova™
H00009970-Q01.10UG |
10 ug |
335.00€
10 microgramos |
Fecha estimada de envío: 31-05-2024 Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
16015205
|
Abnova™
H00009970-Q01.25UG |
25 ug |
508.00€
25 microgramos |
Fecha estimada de envío: 31-05-2024 Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
Descripción
This gene encodes a member of the nuclear receptor superfamily, and is a key regulator of xenobiotic and endobiotic metabolism. The protein binds to DNA as a monomer or a heterodimer with the retinoid X receptor and regulates the transcription of target genes involved in drug metabolism and bilirubin clearance, such as cytochrome P450 family members. Unlike most nuclear receptors, this transcriptional regulator is constitutively active in the absence of ligand but is regulated by both agonists and inverse agonists. Ligand binding results in translocation of this protein to the nucleus, where it activates or represses target gene transcription. These ligands include bilirubin, a variety of foreign compounds, steroid hormones, and prescription drugs. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Sequence: ASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFAGSCEVSKTQEspecificaciones
NP_005113.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
32.12kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
CAR/CAR1/MB67/MGC150433/MGC97144/MGC97209 | |
NR1I3 | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
9970 | |
NR1I3 (Human) Recombinant Protein (Q01) | |
ASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFAGSCEVSKTQ | |
RUO | |
NR1I3 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |