missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human NPAS2 Partial ORF (NP_002509, 646 a.a. - 738 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00004862-Q01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16168451

  • 508.00€ / 25 microgramos
Fecha estimada de envío: 21-08-2024
para ver el stock

Descripción

Descripción

The protein encoded by this gene is a member of the basic helix-loop-helix (bHLH)-PAS family of transcription factors. A similar mouse protein may play a regulatory role in the acquisition of specific types of memory. It also may function as a part of a molecular clock operative in the mammalian forebrain. [provided by RefSeq]

Sequence: NLTTPASTSQDASQCQPSPDFSHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTGRQVKYAQSQTVFQNPDAHPANSSSAPMPVLLMGQAVLH
Especificaciones

Especificaciones

NP_002509
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.97kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
NLTTPASTSQDASQCQPSPDFSHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTGRQVKYAQSQTVFQNPDAHPANSSSAPMPVLLMGQAVLH
RUO
NPAS2
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
4862
NPAS2 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ23138/MGC71151/MOP4/PASD4/bHLHe9
NPAS2
Recombinant
wheat germ expression system
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales