missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human NOXO1 Partial ORF (AAH15917, 1 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00124056-Q01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16101677

  • 518.16€ / 25 microgramos
Envío estimado: 23-12-2021

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

NADPH oxidases (NOXs) catalyze the transfer of electrons from NADPH to molecular oxygen to generate reactive oxygen species (ROS). NOX organizers, such as NOXO1, target NOX activators (see NOXA1; MIM 611255) to NOX and also target NOX to different subcellular compartments (Opitz et al., 2007 [PubMed 17189823]).[supplied by OMIM]

Sequence: MAGPRYPVSVQGAALVQIKRLQTFAFSVRWSDGSDTFVRRSWDEFRQLKTLKETFPVEAGLLRRSDRVLPKLLDAPLLGRVGRTSRGLARLQLLETYSRR
Especificaciones

Especificaciones

AAH15917
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MAGPRYPVSVQGAALVQIKRLQTFAFSVRWSDGSDTFVRRSWDEFRQLKTLKETFPVEAGLLRRSDRVLPKLLDAPLLGRVGRTSRGLARLQLLETYSRR
RUO
NOXO1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
124056
NOXO1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC20258/P41NOX/P41NOXA/P41NOXB/P41NOXC/SH3PXD5/SNX28
NOXO1
Yes
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales