missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human NEDD4L Partial ORF (AAH32597, 1 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00023327-Q01.10ug

Additional Details : Peso : 0.00010kg

 View more versions of this product

Product Code. 16164566

  • 335.00€ / 10 microgramos
Fecha estimada de envío: 20-08-2024
para ver el stock

Description

Description

Sequence: MATGLGEPVYGLSEDEGESRILRVKVVSGIDLAKKDIFGASDPYVKLSLYVADENRELALVQTKTIKKTLNPKWNEEFYFRVNPSNHRLLFEVFDENRLT
Specifications

Specifications

AAH32597
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MATGLGEPVYGLSEDEGESRILRVKVVSGIDLAKKDIFGASDPYVKLSLYVADENRELALVQTKTIKKTLNPKWNEEFYFRVNPSNHRLLFEVFDENRLT
RUO
NEDD4L
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
23327
NEDD4L (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ33870/KIAA0439/NEDD4-2/RSP5/hNedd4-2
NEDD4L
Recombinant
wheat germ expression system
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Promotions

Promotions