missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human MYO9B Partial ORF (AAH18108, 201 a.a. - 290 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00004650-Q01.25ug
Detalles adicionales : Peso : 0.00010kg
Descripción
Sequence: CPDNSDPLTSMKDVLKITTCVEMLIKEQMRKYKVKMEEISQLEAAESIAFRRLSLLRQNAPWPLKLGFSSPYEGVLNKSPKTRDIQEEELEspecificaciones
| AAH18108 | |
| Liquid | |
| 4650 | |
| MYO9B (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CELIAC4/MYR5 | |
| MYO9B | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 35.64kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| CPDNSDPLTSMKDVLKITTCVEMLIKEQMRKYKVKMEEISQLEAAESIAFRRLSLLRQNAPWPLKLGFSSPYEGVLNKSPKTRDIQEEEL | |
| RUO | |
| MYO9B | |
| Wheat Germ (in vitro) | |
| GST |