missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MOGAT3 Partial ORF (NP_835470, 59 a.a. - 107 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00346606-Q01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16192857

  • 310.00€ / 10 microgramos


Fecha estimada de envío
17-02-2021
Añadir a la cesta

Descripción

Descripción

Sequence: YLVWLYVDWDTPNQGGRRSEWIRNRAIWRQLRDYYPVKLVKTAELPPDR
Especificaciones

Especificaciones

NP_835470
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
31.13kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
YLVWLYVDWDTPNQGGRRSEWIRNRAIWRQLRDYYPVKLVKTAELPPDR
RUO
MOGAT3
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
346606
MOGAT3 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DC7|DGAT2L7|MGAT3|MGC119203|MGC119204
MOGAT3
Yes
Videos
SDS
Documentos