missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human MICAL3 Partial ORF (XP_032996.2, 251 a.a. - 340 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00057553-Q01.10ug
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Sequence: DDQHWSDSPSDADRELRLPCPAEGEAELELRVSEDEEKLPASPKHQERGPSQATSPIRSPQESALLFIPVHSPSTEGPQLPPVPAATQEKEspecificaciones
XP_032996.2 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
35.64kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
DDQHWSDSPSDADRELRLPCPAEGEAELELRVSEDEEKLPASPKHQERGPSQATSPIRSPQESALLFIPVHSPSTEGPQLPPVPAATQEK | |
RUO | |
MICAL3 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
57553 | |
MICAL3 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
KIAA0819/MGC189703 | |
MICAL3 | |
Recombinant | |
wheat germ expression system |