missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MCSP Full-length ORF (AAH14593, 1 a.a. - 116 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

341.70€ - 518.16€

Especificaciones

Nombre Human MCSP Full-length ORF (AAH14593, 1 a.a. - 116 a.a.) Recombinant Protein with GST-tag at N-terminal
Recombinante Yes
Método de purificación Glutathione Sepharose 4 Fast Flow
Para utilizar con (aplicación) AP, Array, ELISA, WB-Re
Peso molecular 38.50kDa
Ver más especificaciones

Productos 2
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
16197671
Ver documentos Detalles de la promoción
Abnova™
H00004184-P01.10UG
10 ug
341.70€
10 microgramos
Ver productos alternativos
Ahorre hasta 
»
Envío estimado: 15-03-2022
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
16107681
Ver documentos Detalles de la promoción
Abnova™
H00004184-P01.25UG
25μg
518.16€
25 microgramos
Ver productos alternativos
Ahorre hasta 
»
Envío estimado: 15-03-2022
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Descripción

Descripción

Sperm mitochondria differ in morphology and subcellular localization from those of somatic cells. They are elongated, flattened, and arranged circumferentially to form a helical coiled sheath in the midpiece of the sperm flagellum. The protein encoded by this gene localizes to the capsule associated with the mitochondrial outer membranes and is thought to function in the organization and stabilization of the helical structure of the sperm's mitochondrial sheath. [provided by RefSeq]

Sequence: MCDQTKHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCCIQARCCGLETKPEVSPLNMESEPNSPQTQDKGCQTQQQPHSPQNESRPSK
Especificaciones

Especificaciones

Human MCSP Full-length ORF (AAH14593, 1 a.a. - 116 a.a.) Recombinant Protein with GST-tag at N-terminal
Glutathione Sepharose 4 Fast Flow
38.50kDa
Yes
AP, Array, ELISA, WB-Re
Store at −80°C. Aliquot to avoid repeated freezing and thawing.
SDS
Product Certifications