missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MCSP Full-length ORF (AAH14593, 1 a.a. - 116 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00004184-P01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16107681

  • 518.16€ / 25 microgramos
Envío estimado: 18-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

Sperm mitochondria differ in morphology and subcellular localization from those of somatic cells. They are elongated, flattened, and arranged circumferentially to form a helical coiled sheath in the midpiece of the sperm flagellum. The protein encoded by this gene localizes to the capsule associated with the mitochondrial outer membranes and is thought to function in the organization and stabilization of the helical structure of the sperm's mitochondrial sheath. [provided by RefSeq]

Sequence: MCDQTKHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCCIQARCCGLETKPEVSPLNMESEPNSPQTQDKGCQTQQQPHSPQNESRPSK
Especificaciones

Especificaciones

AAH14593
AP, Array, ELISA, WB-Re
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
38.50kDa
Glutathione Sepharose 4 Fast Flow
25μg
RUO
MCSP
Wheat Germ (in vitro)
GST Tag
wheat germ expression system
Liquid
4184
Human MCSP Full-length ORF (AAH14593, 1 a.a. - 116 a.a.) Recombinant Protein with GST-tag at N-terminal
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at −80°C. Aliquot to avoid repeated freezing and thawing.
HSMCSGEN1, MCS, MCSP, MGC26305, MGC26519
SMCP
Yes
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales