missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MCMDC1 Partial ORF (AAH31658, 1 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00254394-Q01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16102607

  • 341.70€ / 10 microgramos
Envío estimado: 17-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

This gene encodes a protein that shares similarity with minichromosome maintenance (MCM) proteins, which are known to be essential for initiation of DNA replication. [provided by RefSeq]

Sequence: MNSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETNMEIGEYFNMFPSEVLTIFDSALRRSALTILQSLSQPEAVSMKQNLHARI
Especificaciones

Especificaciones

AAH31658
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.41kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MNSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETNMEIGEYFNMFPSEVLTIFDSALRRSALTILQSLSQPEAVSMKQNLHARI
RUO
MCM9
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
254394
MCMDC1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
C6orf61/FLJ13942/FLJ20170/FLJ56845/MCMDC1/MGC35304/dJ329L24.1/dJ329L24.3
MCM9
Yes
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales