missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MARCH2 Partial ORF (NP_057580, 2 a.a. - 99 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00051257-Q01.25ug

Additional Details : Peso : 0.00010kg

 View more versions of this product

Product Code. 16106756

  • 518.16€ / 25 microgramos
Envío estimado: 25-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Description

Description

Sequence: TTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSDGPFCRICHEGANGECLLSPCGCTGTLGAVHKSCLEKWLS
Specifications

Specifications

NP_057580
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.52kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
TTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSDGPFCRICHEGANGECLLSPCGCTGTLGAVHKSCLEKWLS
RUO
MARCH2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
51257
MARCH2 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HSPC240/MARCH-II/RNF172
MARCH2
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers