Abnova™ Human LZTFL1 Partial ORF (AAH25988.1, 39 a.a. - 120 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca: Abnova™ H00054585-Q02.10ug

Código de producto. 16025545

Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Sequence: LKESRLVEDTFTIDEVSEVLNGLQAVVHSEVESELINTAYTNVLLLRQLFAQAEKWYLKLQTDISELENQELLEQVAEFEKA

Especificaciones

Número de acceso	AAH25988.1
Formulación	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Peso molecular	34.65kDa
Pruebas de control de calidad	12.5% SDS-PAGE Stained with Coomassie Blue.
Inmunógeno	LKESRLVEDTFTIDEVSEVLNGLQAVVHSEVESELINTAYTNVLLLRQLFAQAEKWYLKLQTDISELENQELLEQVAEFEKA
Estado normativo	RUO
Nombre común	LZTFL1
Especie	Wheat Germ (in vitro)
Etiqueta de proteína	GST
Formulario	Liquid

Para utilizar con (aplicación)	Antibody Production, ELISA, Protein Array, Western Blot
ID de gen (Entrez)	54585
Nombre	LZTFL1 (Human) Recombinant Protein (Q02)
Cantidad	10 ug
Requisitos de almacenamiento	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias de gen	FLJ36386
Símbolo de gen	LZTFL1
Recombinante	Recombinant
Sistema de expresión	wheat germ expression system

Sugerencias de productos

Descripción