missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human LTA Partial ORF (AAH34729, 106 a.a. - 205 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Especificaciones
| Número de acceso | AAH34729 |
|---|---|
| Para utilizar con (aplicación) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulación | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| ID de gen (Entrez) | 4049 |
| Peso molecular | 36.63kDa |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
16117471
|
Abnova™
H00004049-Q01.25UG |
25 ug |
508.00€
25 microgramos |
Fecha estimada de envío: 31-05-2024 Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
|
16107471
|
Abnova™
H00004049-Q01.10UG |
10 ug |
335.00€
10 microgramos |
Fecha estimada de envío: 31-05-2024 Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
Descripción
The encoded protein, a member of the tumor necrosis factor family, is a cytokine produced by lymphocytes. The protein is highly inducible, secreted, and forms heterotrimers with lymphotoxin-beta which anchor lymphotoxin-alpha to the cell surface. This protein also mediates a large variety of inflammatory, immunostimulatory, and antiviral responses, is involved in the formation of secondary lymphoid organs during development and plays a role in apoptosis. Genetic variations in this gene are associated with susceptibility to leprosy type 4 and psoriatic arthritis
Sequence: IYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFALEspecificaciones
| AAH34729 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.63kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| LT/TNFB/TNFSF1 | |
| LTA | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 4049 | |
| LTA (Human) Recombinant Protein (Q01) | |
| IYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL | |
| RUO | |
| LTA | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |