missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human LRRC41 Partial ORF (NP_006360, 86 a.a. - 195 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00010489-Q01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16195192

  • 302.00€ / 10 microgramos


Fecha estimada de envío
19-10-2020
Añadir a la cesta

Descripción

Descripción

Sequence: ERIEETALKKGLSTQAIWRRLWDELMKTRPSSLESVTCWRAKFMEAFFSHVLRGTIDVSSDRRLCDQRFSPLLHSSRHVRQLTICNMLQGATELVAEPNRRVLETLASSL
Especificaciones

Especificaciones

NP_006360
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.84kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
ERIEETALKKGLSTQAIWRRLWDELMKTRPSSLESVTCWRAKFMEAFFSHVLRGTIDVSSDRRLCDQRFSPLLHSSRHVRQLTICNMLQGATELVAEPNRRVLETLASSL
RUO
LRRC41
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
10489
LRRC41 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC126571|MGC126573|MUF1|PP7759|RP4-636H5.2
LRRC41
Yes
Videos
Documentos