missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human LOC494141 Full-length ORF (AAH56262.1, 1 a.a. - 154 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00494141-P01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16100774

  • 335.00€ / 10 microgramos
Envío estimado: 14-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Description

Description

Sequence: MKKEELKQHDGFRSSWKETTNTNIFETRYVTSYYRFSEMKHYLCGCCAAFNNVAITFLIQKVLFPQQLYGIKTGDAILQLRTDGFRNLYRGIFPRLMQKTTTLALTFGLYEDLSYLLHKHVSAPEFATCGVAAVLAGTTEAIFTSDIASRPQAP
Specifications

Specifications

AAH56262.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
43.9kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
LOC494141
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
494141
LOC494141 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MKKEELKQHDGFRSSWKETTNTNIFETRYVTSYYRFSEMKHYLCGCCAAFNNVAITFLIQKVLFPQQLYGIKTGDAILQLRTDGFRNLYRGIFPRLMQKTTTLALTFGLYEDLSYLLHKHVSAPEFATCGVAAVLAGTTEAIFTSDIASRPQAP
RUO
LOC494141
Yes
Videos
SDS
missing translation for 'documents'
Product Certifications
Special Offers

Special Offers