missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human KIAA0992 Partial ORF (NP_057165, 775 a.a. - 839 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00023022-Q01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16104356

  • 508.00€ / 25 microgramos
Envío estimado: 14-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

Palladin is a component of actin-containing microfilaments that control cell shape, adhesion, and contraction.[supplied by OMIM]

Sequence: MAPFFEMKLKHYKIFEGMPVTFTCRVAGNPKPKIYWFKDGKQISPKSDHYTIQRDLDGTCSLHTT
Especificaciones

Especificaciones

NP_057165
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
32.89kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MAPFFEMKLKHYKIFEGMPVTFTCRVAGNPKPKIYWFKDGKQISPKSDHYTIQRDLDGTCSLHTT
RUO
PALLD
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
23022
KIAA0992 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CGI-151/FLJ22190/FLJ38193/FLJ39139/KIAA0992/PNCA1/SIH002
PALLD
Yes
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales