missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human IRF8 Partial ORF (NP_002154, 122 a.a. - 218 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00003394-Q01.10ug
Detalles adicionales : Peso : 0.00010kg
Descripción
Interferon consensus sequence-binding protein (ICSBP) is a transcription factor of the interferon (IFN) regulatory factor (IRF) family. Proteins of this family are composed of a conserved DNA-binding domain in the N-terminal region and a divergent C-terminal region that serves as the regulatory domain. The IRF family proteins bind to the IFN-stimulated response element (ISRE) and regulate expression of genes stimulated by type I IFNs, namely IFN-alpha and IFN-beta. IRF family proteins also control expression of IFN-alpha and IFN-beta-regulated genes that are induced by viral infection. [provided by RefSeq]
Sequence: LGVATAGCVNEVTEMECGRSEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQQPSTGVPLVTGYTTYDAHHSAFSQMVISFYYGGKLVGQEspecificaciones
| NP_002154 | |
| Liquid | |
| 3394 | |
| IRF8 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| H-ICSBP/ICSBP/ICSBP1/IRF-8 | |
| IRF8 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.41kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| LGVATAGCVNEVTEMECGRSEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQQPSTGVPLVTGYTTYDAHHSAFSQMVISFYYGGKLVGQ | |
| RUO | |
| IRF8 | |
| Wheat Germ (in vitro) | |
| GST |