missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human HYAL1 Partial ORF (NP_009296, 60 a.a. - 159 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00003373-Q01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16199734

  • 302.00€ / 10 microgramos


Fecha estimada de envío
29-10-2020
Añadir a la cesta

Descripción

Descripción

Sequence: ANPGQTFRGPDMTIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHLARTFQDILAAIPAPDFSGLAVIDWEAWRPRWAFNWDTKDIYRQRSRALVQAQH
Especificaciones

Especificaciones

NP_009296
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
ANPGQTFRGPDMTIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHLARTFQDILAAIPAPDFSGLAVIDWEAWRPRWAFNWDTKDIYRQRSRALVQAQH
RUO
HYAL1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
3373
HYAL1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HYAL-1|LUCA1|MGC45987|NAT6
HYAL1
Yes
Videos
Documentos