missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human HSPA6 Partial ORF (NP_002146.2, 544 a.a. - 643 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00003310-Q01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16199684

  • 458.00€ / 25 microgramos


Fecha estimada de envío
29-10-2020
Añadir a la cesta

Descripción

Descripción

Sequence: LEAHVFHVKGSLQEESLRDKIPEEDRRKMQDKCREVLAWLEHNQLAEKEEYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEVD
Especificaciones

Especificaciones

NP_002146.2
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
LEAHVFHVKGSLQEESLRDKIPEEDRRKMQDKCREVLAWLEHNQLAEKEEYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEVD
RUO
HSPA6
Yes
wheat germ expression system
Liquid
3310
HSPA6 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HSPA6
Wheat Germ (in vitro)
GST
Videos
Documentos