missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human HRMT1L6 Partial ORF (NP_060607, 241 a.a. - 316 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Specifications
| Número de acceso | NP_060607 |
|---|---|
| Para utilizar con (aplicación) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulación | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| ID de gen (Entrez) | 55170 |
| Peso molecular | 34.1kDa |
| Product Code | Brand | Cantidad | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Cantidad | Price | Quantity & Availability | |||||
|
16177956
|
Abnova™
H00055170-Q01.25UG |
25 ug |
508.00€
25 microgramos |
Fecha estimada de envío: 04-06-2024 Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
|
16167956
|
Abnova™
H00055170-Q01.10UG |
10 ug |
335.00€
10 microgramos |
Fecha estimada de envío: 04-06-2024 Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
Description
Protein arginine N-methyltransferases, such as PRMT6, catalyze the sequential transfer of a methyl group from S-adenosyl-L-methionine to the side chain nitrogens of arginine residues within proteins to form methylated arginine derivatives and S-adenosyl-L-homocysteine.[supplied by OMIM]
Sequence: ESEKPLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPRRLRVLLRYKVGDQEEKTKDFAMEDSpecifications
| NP_060607 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 34.1kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FLJ10559/HRMT1L6 | |
| PRMT6 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 55170 | |
| HRMT1L6 (Human) Recombinant Protein (Q01) | |
| ESEKPLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPRRLRVLLRYKVGDQEEKTKDFAMED | |
| RUO | |
| PRMT6 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |