missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human HDGF Partial ORF (NP_004485, 184 a.a. - 240 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00003068-Q01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16109234

  • 518.16€ / 25 microgramos
Envío estimado: 10-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Description

Description

This gene encodes a member of the hepatoma-derived growth factor family. The encoded protein has mitogenic and DNA-binding activity and may play a role in cellular proliferation and differentiation. This gene was thought initially to be located on chromosome X, however, that location has been determined to correspond to a related pseudogene. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq]

Sequence: TLEVERPLPMEVEKNSTPSEPGSGRGPPQEEEEEEDEEEEATKEDAEAPGIRDHESL
Specifications

Specifications

NP_004485
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
32.01kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
TLEVERPLPMEVEKNSTPSEPGSGRGPPQEEEEEEDEEEEATKEDAEAPGIRDHESL
RUO
HDGF
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
3068
HDGF (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DKFZp686J1764/FLJ96580/HMG1L2
HDGF
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers