missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human H2AFX Partial ORF (AAH11694.1, 1 a.a. - 96 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00003014-Q01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16195971

  • 458.00€ / 25 microgramos


Fecha estimada de envío
19-10-2020
Añadir a la cesta

Descripción

Descripción

Sequence: MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNK
Especificaciones

Especificaciones

AAH11694.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.19kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNK
RUO
H2AFX
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
3014
H2AFX (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
H2A.X|H2A/X|H2AX
H2AFX
Yes
Videos
Documentos