missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human GPC1 Partial ORF (NP_002072.2, 71 a.a. - 165 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Especificaciones
| Número de acceso | NP_002072.2 |
|---|---|
| Para utilizar con (aplicación) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulación | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| ID de gen (Entrez) | 2817 |
| Peso molecular | 36.08kDa |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
16034075
|
Abnova™
H00002817-Q02.25UG |
25 ug |
508.00€
25 microgramos |
Fecha estimada de envío: 05-06-2024 Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
|
16024075
|
Abnova™
H00002817-Q02.10UG |
10 ug |
335.00€
10 microgramos |
Fecha estimada de envío: 05-06-2024 Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
Descripción
Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. [provided by RefSeq]
Sequence: SEMEENLANRSHAELETALRDSSRVLQAMLATQLRSFDDHFQHLLNDSERTLQATFPGAFGELYTQNARAFRDLYSELRLYYRGANLHLEETLAEEspecificaciones
| NP_002072.2 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.08kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FLJ38078/glypican | |
| GPC1 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 2817 | |
| GPC1 (Human) Recombinant Protein (Q02) | |
| SEMEENLANRSHAELETALRDSSRVLQAMLATQLRSFDDHFQHLLNDSERTLQATFPGAFGELYTQNARAFRDLYSELRLYYRGANLHLEETLAE | |
| RUO | |
| GPC1 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |