missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human GLDC Partial ORF (NP_000161.1, 922 a.a. - 1020 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00002731-Q01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16108714

  • 508.00€ / 25 microgramos
Envío estimado: 14-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

The enzyme system for cleavage of glycine (glycine cleavage system; GCS; EC 2.1.2.10), which is confined to the mitochondria, is composed of 4 protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase). Glycine encephalopathy (GCE; MIM 605899) may be due to a defect in any one of these enzymes; see MIM 238310, MIM 238330, and MIM 238331.[supplied by OMIM]

Sequence: AMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVTSSHWDRPYSREVAAFPLPFMKPENKFWPTIARIDDIYGDQHLVCTCPPMEVYESPFSEQKRASS
Especificaciones

Especificaciones

NP_000161.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
AMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVTSSHWDRPYSREVAAFPLPFMKPENKFWPTIARIDDIYGDQHLVCTCPPMEVYESPFSEQKRASS
RUO
GLDC
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
2731
GLDC (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
GCE/GCSP/HYGN1/MGC138198/MGC138200/NKH
GLDC
Yes
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales