Learn More
Abnova™ Human GLDC Partial ORF (NP_000161.1, 922 a.a. - 1020 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00002731-Q01.25ug
Detalles adicionales : Peso : 0.00010kg
Descripción
The enzyme system for cleavage of glycine (glycine cleavage system; GCS; EC 2.1.2.10), which is confined to the mitochondria, is composed of 4 protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase). Glycine encephalopathy (GCE; MIM 605899) may be due to a defect in any one of these enzymes; see MIM 238310, MIM 238330, and MIM 238331.[supplied by OMIM]
Sequence: AMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVTSSHWDRPYSREVAAFPLPFMKPENKFWPTIARIDDIYGDQHLVCTCPPMEVYESPFSEQKRASSEspecificaciones
NP_000161.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.63kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
AMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVTSSHWDRPYSREVAAFPLPFMKPENKFWPTIARIDDIYGDQHLVCTCPPMEVYESPFSEQKRASS | |
RUO | |
GLDC | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
2731 | |
GLDC (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
GCE/GCSP/HYGN1/MGC138198/MGC138200/NKH | |
GLDC | |
Recombinant | |
wheat germ expression system |