missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human EXO1 Partial ORF (AAH07491, 747 a.a. - 846 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00009156-Q01.10ug
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
This gene encodes a protein with 5' to 3' exonuclease activity as well as an RNase H activity. It is similar to the Saccharomyces cerevisiae protein Exo1 which interacts with Msh2 and which is involved in mismatch repair and recombination. Alternative splicing of this gene results in three transcript variants encoding two different isoforms. [provided by RefSeq]
Sequence: ADSLSTTKIKPLGPARASGLSKKPASIQKRKHHNAENKPGLQIKLNELWKNFGFKKDSEKLPPCKKPLSPVRDNIQLTPEAEEDIFNKPECGRVQRAIFQEspecificaciones
AAH07491 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.63kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
ADSLSTTKIKPLGPARASGLSKKPASIQKRKHHNAENKPGLQIKLNELWKNFGFKKDSEKLPPCKKPLSPVRDNIQLTPEAEEDIFNKPECGRVQRAIFQ | |
RUO | |
EXO1 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
9156 | |
EXO1 (Human) Recombinant Protein (Q01) | |
10 μg | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
HEX1/hExoI | |
EXO1 | |
Recombinant | |
wheat germ expression system |