missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ESD Partial ORF (NP_001975.1, 183 a.a. - 281 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00002098-Q01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16107804

  • 508.00€ / 25 microgramos
Envío estimado: 14-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

This gene encodes a serine hydrolase that belongs to the esterase D family. The encoded enzyme is active toward numerous substrates including O-acetylated sialic acids, and it may be involved in the recycling of sialic acids. This gene is used as a genetic marker for retinoblastoma and Wilson's disease. [provided by RefSeq]

Sequence: WGKKAFSGYLGTDQSKWKAYDATHLVKSYPGSQLDILIDQGKDDQFLLDGQLLPDNFIAACTEKKIPVVFRLQEGYDHSYYFIATFITDHIRHHAKYLN
Especificaciones

Especificaciones

NP_001975.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
WGKKAFSGYLGTDQSKWKAYDATHLVKSYPGSQLDILIDQGKDDQFLLDGQLLPDNFIAACTEKKIPVVFRLQEGYDHSYYFIATFITDHIRHHAKYLN
RUO
ESD
Yes
wheat germ expression system
Liquid
2098
ESD (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ESD
Wheat Germ (in vitro)
GST
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales