missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Epsin 2 (aa 213-265) Control Fragment Recombinant Protein

Código de producto. 30201324
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30201324

Marca: Invitrogen™ RP106456

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Epsin2 plays a role in the formation of clathrin-coated invaginations and endocytosis. It binds to EPS15 (via the NPF repeat domain), as well as to AP-2 and clathrin (via the DPW repeat domain). The protein resides in the cytoplasm, in punctate structures throughout the cell, associated with clathrin-coated vesicles, and is particularly concentrated in the region of the Golgi complex. Highest expression is found in brain, with lower levels detected in lung and liver.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso O95208
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 22905
Nombre Human Epsin 2 (aa 213-265) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 9530051D10Rik; AA536924; EH domain binding protein epsin 2; EHB21; EPN2; Eps15 binding protein; EPS-15-interacting protein 2; epsin 2; epsin-2; Ibp2; Intersectin-EH-binding protein 2; KIAA1065
Nombre común Epsin 2
Símbolo de gen EPN2
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia PLGQSEELQPLSQRHPFLPHLGLASRPNGDWSQPCLTCDRAARATSPRVSSEL
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado