missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human EDG3 Partial ORF (NP_005217.2, 302 a.a. - 378 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00001903-Q01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16107454

  • 518.16€ / 25 microgramos
Envío estimado: 24-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

This gene encodes a member of the EDG family of receptors, which are G protein-coupled receptors. This protein has been identified as a functional receptor for sphingosine 1-phosphate and likely contributes to the regulation of angiogenesis and vascular endothelial cell function. [provided by RefSeq]

Sequence: SKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAPSSCIMDKNAALQNGIFCN
Especificaciones

Especificaciones

NP_005217.2
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.21kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAPSSCIMDKNAALQNGIFCN
RUO
S1PR3
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
1903
EDG3 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
EDG-3/EDG3/FLJ37523/FLJ93220/LPB3/MGC71696/S1P3
S1PR3
Yes
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales