missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human DPAGT1 Partial ORF (NP_001373, 296 a.a. - 377 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00001798-Q01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16197294

  • 458.00€ / 25 microgramos


Fecha estimada de envío
26-10-2020
Añadir a la cesta

Descripción

Descripción

Sequence: IIPCPRHRIPRLNIKTGKLEMSYSKFKTKSLSFLGTFILKVAESLQLVTVHQSETEDGEFTECNNMTLINLLLKVLGPIHER
Especificaciones

Especificaciones

NP_001373
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.76kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
IIPCPRHRIPRLNIKTGKLEMSYSKFKTKSLSFLGTFILKVAESLQLVTVHQSETEDGEFTECNNMTLINLLLKVLGPIHER
RUO
DPAGT1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
1798
DPAGT1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ALG7|CDG-Ij|D11S366|DGPT|DPAGT|DPAGT2|G1PT|GPT|UAGT|UGAT
DPAGT1
Yes
Videos
Documentos