missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human DKFZp434B1231 Partial ORF (NP_840059, 720 a.a. - 818 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00091156-Q01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16191147

  • 467.00€ / 25 microgramos


Fecha estimada de envío
17-02-2021
Añadir a la cesta

Descripción

Descripción

Sequence: GILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNP
Especificaciones

Especificaciones

NP_840059
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
GILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNP
RUO
IGFN1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
91156
DKFZp434B1231 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DKFZp434B1231|EEF1A2BP1
IGFN1
Yes
Videos
SDS
Documentos