missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human DEADC1 Full-length ORF (ENSP00000356566, 1 a.a. - 144 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00134637-P02.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16198043

  • 458.00€ / 25 microgramos


Fecha estimada de envío
29-10-2020
Añadir a la cesta

Descripción

Descripción

Sequence: MVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCRQSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS
Especificaciones

Especificaciones

ENSP00000356566
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
42.5kDa
Glutathione Sepharose 4 Fast Flow
25 ug
RUO
ADAT2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
134637
DEADC1 (Human) Recombinant Protein (P02)
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DEADC1|DKFZp686L1118|FLJ44213|TAD2|dJ20N2|dJ20N2.1
ADAT2
Yes
Videos
Documentos